PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00790.1.g00220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 416aa    MW: 45386.1 Da    PI: 6.9438
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00790.1.g00220.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.91.7e-072669339
                      zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                                  +r C+ + + +++++C +++ +lC+ C  + H+        H+v
  Zmw_sc00790.1.g00220.1.sm.mk 26 ARSCDGCMRRRARWHCPEDDAFLCQACDAAVHSAnplarrhHRV 69
                                  678*****************************668888885655 PP

2CCT66.48.2e-23333376144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Zmw_sc00790.1.g00220.1.sm.mk 333 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT 376
                                   9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.9112471IPR000315B-box-type zinc finger
SMARTSM003363.7E-82471IPR000315B-box-type zinc finger
PfamPF006431.8E-52668IPR000315B-box-type zinc finger
CDDcd000212.25E-102771No hitNo description
PfamPF062039.5E-18333375IPR010402CCT domain
PROSITE profilePS5101715.993333375IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MTNPGTAAAA VATAAATGAV LGARTARSCD GCMRRRARWH CPEDDAFLCQ ACDAAVHSAN  60
PLARRHHRVR LPTASSSSSS PRCDPDAPAW LHGLKRGPRT PRSKPGSKHE AASAAIPAAA  120
SAAVPDLEAE DSGSGIVGDT YIEHGLLDDD DDEDILYLVP EFDPMLAELY NPVDDEGEEQ  180
KPVCLISTET SPEFASGSAD AKGLSAFDVP DMELASFAAD MESLLMGVEE GFDHPGFLSE  240
QKPQVNVDFG TDLEVTATPA PEREDKKRKR PQMILKLDYE GVIASWAREG GSPWFHGERR  300
PHLDPNDSWP DFSAGIVRGG LVCNVTAVTR GEREARVSRY REKRRTRLFA KKIRYEVRKL  360
NAEKRPRMKG RFVKRTALPP LPRPPQPSQQ QKPQRAPPPT GMALAPQVGV HGHLRF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1343359RRTRLFAKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982006.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLK4AAN00.0K4AAN0_SETIT; Uncharacterized protein
STRINGSi035937m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100042228